PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Migut.N00514.1.p
Common NameLOC105963204, MIMGU_mgv1a009986mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe
Family BES1
Protein Properties Length: 326aa    MW: 34971.8 Da    PI: 8.2706
Description BES1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Migut.N00514.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF822217.72.7e-67301611133
            DUF822   1 ggsgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgskpleeaeaagssasaspess 93 
                       g+++rkp+w+ErEnn+rRERrRRa+aakiy+GLRaqGny+lpk++DnneVlkALc+eAGw+ve+DGttyrkgskp   +e++g+s++++p+ss
  Migut.N00514.1.p  30 GSGRRKPSWRERENNRRRERRRRAVAAKIYTGLRAQGNYNLPKHCDNNEVLKALCAEAGWTVEPDGTTYRKGSKPS-PMEIGGTSNNITPCSS 121
                       6899***********************************************************************9.**************** PP

            DUF822  94 lqsslkssalaspvesysaspksssfpspssldsislasa 133
                        + s+ ss++asp++sy++sp+sssfpsps+ d +sl+++
  Migut.N00514.1.p 122 RNPSPPSSYFASPIPSYQPSPSSSSFPSPSRQDGNSLSHP 161
                       **********************************999866 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056871.0E-6131158IPR008540BES1/BZR1 plant transcription factor, N-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 326 aa     Download sequence    Send to blast
MMWEAGGSTA SSSAAGGAGG SGGGAGDGGG SGRRKPSWRE RENNRRRERR RRAVAAKIYT  60
GLRAQGNYNL PKHCDNNEVL KALCAEAGWT VEPDGTTYRK GSKPSPMEIG GTSNNITPCS  120
SRNPSPPSSY FASPIPSYQP SPSSSSFPSP SRQDGNSLSH PFAFLLNSIP NSPLRISSSC  180
PVTPPLSSPT RRQQTFNLEN LATEYSMTAL NMPFFASAPA SPTRNQRLYT QATIPECDES  240
ETSTVDSCRW MNFQAVVPTS PTFNLVKRAA EVAPCEGDVL LLDKGKGKEF DFESMAVKPW  300
EGERIHEVGL DDLELTLGSG NNSRI*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
13251RRKPSWRERENNRRRERRRR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012843043.10.0PREDICTED: protein BRASSINAZOLE-RESISTANT 1-like
SwissprotQ8S3071e-99BZR1_ARATH; Protein BRASSINAZOLE-RESISTANT 1
TrEMBLA0A022QZN70.0A0A022QZN7_ERYGU; Uncharacterized protein
STRINGPGSC0003DMT4000398791e-125(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA28122454
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G19350.34e-90BES1 family protein